3be3/2/1:A/2:B

Sequences
>3be3-a2-m1-cA (length=75) [Search sequence]
QDFRPGVYRHYKGDHYLALGLARADETDEVVVVYTRLYARAGLPSTRLLRIWNETVDTGA
GPQPRFAYVGHVTPE
>3be3-a2-m2-cB (length=76) [Search sequence]
AQDFRPGVYRHYKGDHYLALGLARADETDEVVVVYTRLYARAGLPSTRLLRIWNETVDTG
AGPQPRFAYVGHVTPE
Structure information
PDB ID 3be3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a protein belonging to pfam DUF1653 from Bordetella bronchiseptica
Assembly ID 2
Resolution 2.04Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 50
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession A0A0H3LS10 A0A0H3LS10
Species 257310 (Bordetella bronchiseptica RB50) 257310 (Bordetella bronchiseptica RB50)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3be3-a2-m1-cA_3be3-a2-m2-cB.pdb.gz
Full biological assembly
Download: 3be3-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3be3/1/1:A/2:B 3be3/2/2:A/1:B
Other dimers with similar sequences but different poses
  • 3be3/2/2:A/2:B 3be3/2/1:A/1:B
  • 3be3/2/1:B/2:B 3be3/2/1:A/2:A
  • [Back to Home]