3bex/3/1:E/1:F

Sequences

>3bex-a3-m1-cE (length=248) [Search sequence]

MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGI
GVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEY
GKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGK
DTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIK
GVYHFCFG

>3bex-a3-m1-cF (length=248) [Search sequence]

Structure information

PDB ID	3bex (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Type III pantothenate kinase from Thermotoga maritima complexed with pantothenate
Assembly ID	3
Resolution	1.51Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	176
Sequence identity between the two chains	1.0
PubMed citation	18186650

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	Q9WZY5	Q9WZY5
Species	243274 (Thermotoga maritima MSB8)	243274 (Thermotoga maritima MSB8)
Function annotation	BioLiP:3bexE	BioLiP:3bexF

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3bex-a3-m1-cE_3bex-a3-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3bex-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2gtd/1/1:A/1:B 2gtd/2/1:C/1:D 2gtd/3/1:E/1:F 2gtd/4/1:A/1:B 2gtd/4/1:C/1:D 2gtd/4/1:E/1:F 3bex/1/1:A/1:B 3bex/2/1:C/1:D 3bf1/1/1:A/1:B 3bf1/2/1:C/1:D 3bf1/3/1:E/1:F 3bf3/1/1:A/1:B 3bf3/2/1:C/1:D 3bf3/3/1:E/1:F
Other dimers with similar sequences but different poses	2gtd/4/1:D/1:F 2gtd/4/1:A/1:D 2gtd/4/1:A/1:F 2gtd/4/1:B/1:C 2gtd/4/1:B/1:E 2gtd/4/1:C/1:E