3bf4/1/1:B/1:A

Sequences

>3bf4-a1-m1-cB (length=105) [Search sequence]

FQGIKVNVYPYTEGARFDHAYYCDRHPVKARLGSACAYYTVEKGLAGSASGAPPAFVACA FICDSAENFYAAYYHGAEILGDIANYTDIAPVLQISEVVVERSDR

>3bf4-a1-m1-cA (length=109) [Search sequence]

ENLYFQGIKVNVYPYTEGARFDHAYYCDRHPVKARLGSACAYYTVEKGLAGSASGAPPAF VACAFICDSAENFYAAYYHGAEILGDIANYTDIAPVLQISEVVVERSDR

Structure information

PDB ID	3bf4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 A resolution
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	108
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q46P95	Q46P95
Species	264198 (Cupriavidus pinatubonensis JMP134)	264198 (Cupriavidus pinatubonensis JMP134)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3bf4-a1-m1-cB_3bf4-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3bf4-assembly1.cif.gz