3bf4/1/1:B/1:A

Sequences
>3bf4-a1-m1-cB (length=105) [Search sequence]
FQGIKVNVYPYTEGARFDHAYYCDRHPVKARLGSACAYYTVEKGLAGSASGAPPAFVACA
FICDSAENFYAAYYHGAEILGDIANYTDIAPVLQISEVVVERSDR
>3bf4-a1-m1-cA (length=109) [Search sequence]
ENLYFQGIKVNVYPYTEGARFDHAYYCDRHPVKARLGSACAYYTVEKGLAGSASGAPPAF
VACAFICDSAENFYAAYYHGAEILGDIANYTDIAPVLQISEVVVERSDR
Structure information
PDB ID 3bf4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 A resolution
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 108
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q46P95 Q46P95
Species 264198 (Cupriavidus pinatubonensis JMP134) 264198 (Cupriavidus pinatubonensis JMP134)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3bf4-a1-m1-cB_3bf4-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3bf4-assembly1.cif.gz

[Back to Home]