3bfb/2/1:A/2:A

Sequences
>3bfb-a2-m1-cA (length=117) [Search sequence]
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDE
ANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
>3bfb-a2-m2-cA (length=117) [Search sequence]
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDE
ANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Structure information
PDB ID 3bfb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a pheromone binding protein from Apis mellifera in complex with the 9-keto-2(E)-decenoic acid
Assembly ID 2
Resolution 2.15Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
PubMed citation 18508083
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q9U9J6 Q9U9J6
Species 7460 (Apis mellifera) 7460 (Apis mellifera)
Function annotation BioLiP:3bfbA BioLiP:3bfbA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3bfb-a2-m1-cA_3bfb-a2-m2-cA.pdb.gz
Full biological assembly
Download: 3bfb-assembly2.cif.gz

[Back to Home]