3bhp/4/1:A/1:C

Sequences
>3bhp-a4-m1-cA (length=50) [Search sequence]
ISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSKNTLKSV
>3bhp-a4-m1-cC (length=52) [Search sequence]
ISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSKNTLKSVLE
Structure information
PDB ID 3bhp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of UPF0291 protein ynzC from Bacillus subtilis at resolution 2.0 A. Northeast Structural Genomics Consortium target SR384
Assembly ID 4
Resolution 2.01Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession O31818 O31818
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3bhp-a4-m1-cA_3bhp-a4-m1-cC.pdb.gz
Full biological assembly
Download: 3bhp-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3bhp/4/1:B/1:A 3bhp/4/1:B/1:C

[Back to Home]