3bid/4/1:H/1:G

Sequences
>3bid-a4-m1-cH (length=56) [Search sequence]
YFEIYKDAKGEYRWRLKAANHEIIAQGEGYTSKQNCQHAVDLLKSTTAATPVKEVL
>3bid-a4-m1-cG (length=59) [Search sequence]
YFEIYKDAKGEYRWRLKAANHEIIAQGEGYTSKQNCQHAVDLLKSTTAATPVKEVLEHH
Structure information
PDB ID 3bid (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the NMB1088 protein from Neisseria meningitidis. Northeast Structural Genomics Consortium target MR91
Assembly ID 4
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 88
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H G
UniProt accession Q7DDI1 Q7DDI1
Species 122586 (Neisseria meningitidis MC58) 122586 (Neisseria meningitidis MC58)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3bid-a4-m1-cH_3bid-a4-m1-cG.pdb.gz
Full biological assembly
Download: 3bid-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3bid/1/1:B/1:A 3bid/2/1:D/1:C 3bid/3/1:F/1:E

[Back to Home]