3bkf/1/2:A/4:A

Sequences

>3bkf-a1-m2-cA (length=66) [Search sequence]

GTQGFAVLSYVYEHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGH LQCLPK

>3bkf-a1-m4-cA (length=66) [Search sequence]

GTQGFAVLSYVYEHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGH LQCLPK

Structure information

PDB ID	3bkf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Zinc-bound C-terminal Domain of NikR
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	28
Sequence identity between the two chains	1.0
PubMed citation	18193897

Chain information

	Chain 1	Chain 2
Model ID	2	4
Chain ID	A	A
UniProt accession	P0A6Z6	P0A6Z6
Species	562 (Escherichia coli)	562 (Escherichia coli)
Function annotation	BioLiP:3bkfA	BioLiP:3bkfA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3bkf-a1-m2-cA_3bkf-a1-m4-cA.pdb.gz

Full biological assembly Download: 3bkf-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1q5v/1/1:A/1:C 3bkf/1/1:A/3:A 3bku/1/1:A/1:C
Other dimers with similar sequences but different poses	3bkf/2/1:A/2:A 1q5v/1/1:A/1:B 1q5v/1/1:C/1:D 3bkf/1/1:A/2:A 3bkf/1/3:A/4:A