3bkf/2/1:A/2:A

Sequences
>3bkf-a2-m1-cA (length=66) [Search sequence]
GTQGFAVLSYVYEHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGH
LQCLPK
>3bkf-a2-m2-cA (length=66) [Search sequence]
GTQGFAVLSYVYEHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGH
LQCLPK
Structure information
PDB ID 3bkf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Zinc-bound C-terminal Domain of NikR
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
PubMed citation 18193897
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P0A6Z6 P0A6Z6
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:3bkfA BioLiP:3bkfA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3bkf-a2-m1-cA_3bkf-a2-m2-cA.pdb.gz
Full biological assembly
Download: 3bkf-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1q5v/1/1:A/1:B 1q5v/1/1:C/1:D 3bkf/1/1:A/2:A 3bkf/1/3:A/4:A
Other dimers with similar sequences but different poses
  • 3bkf/1/2:A/4:A 1q5v/1/1:A/1:C 3bkf/1/1:A/3:A 3bku/1/1:A/1:C
    		•

    [Back to Home]