3bpd/2/1:N/1:M

Sequences
>3bpd-a2-m1-cN (length=89) [Search sequence]
LKGLRRLVLDVLKPHEPKTIVFALKLSELENVDGVNIHLSEIDQATENIKITILGNNLDY
EQIKGVIEDGGVIHSVDEVVAGKIIVESV
>3bpd-a2-m1-cM (length=90) [Search sequence]
SLKGLRRLVLDVLKPHEPKTIVFALKLSELENVDGVNIHLSEIDQATENIKITILGNNLD
YEQIKGVIEDGGVIHSVDEVVAGKIIVESV
Structure information
PDB ID 3bpd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of an uncharacterized protein (O28723_ARCFU) from Archaeoglobus fulgidus
Assembly ID 2
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 68
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID N M
UniProt accession O28723 O28723
Species 224325 (Archaeoglobus fulgidus DSM 4304) 224325 (Archaeoglobus fulgidus DSM 4304)
Function annotation BioLiP:3bpdN BioLiP:3bpdM
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3bpd-a2-m1-cN_3bpd-a2-m1-cM.pdb.gz
Full biological assembly
Download: 3bpd-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3bpd/1/1:A/1:B 3bpd/1/1:A/1:G 3bpd/1/1:B/1:C 3bpd/1/1:C/1:D 3bpd/1/1:D/1:E 3bpd/1/1:E/1:F 3bpd/1/1:G/1:F 3bpd/2/1:I/1:H 3bpd/2/1:I/1:J 3bpd/2/1:J/1:K 3bpd/2/1:K/1:L 3bpd/2/1:L/1:M 3bpd/2/1:N/1:H

[Back to Home]