3bs3/1/1:A/2:A

Sequences
>3bs3-a1-m1-cA (length=58) [Search sequence]
LNRIKVVLAEKQRTNRWLAEQGKSENTISRWCSNKSQPSLDLVKVAELLNVDPRQLIN
>3bs3-a1-m2-cA (length=58) [Search sequence]
LNRIKVVLAEKQRTNRWLAEQGKSENTISRWCSNKSQPSLDLVKVAELLNVDPRQLIN
Structure information
PDB ID 3bs3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a putative DNA-binding protein from Bacteroides fragilis
Assembly ID 1
Resolution 1.65Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q5LGD2 Q5LGD2
Species 272559 (Bacteroides fragilis NCTC 9343) 272559 (Bacteroides fragilis NCTC 9343)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3bs3-a1-m1-cA_3bs3-a1-m2-cA.pdb.gz
Full biological assembly
Download: 3bs3-assembly1.cif.gz

[Back to Home]