3bv8/2/5:A/6:A

Sequences
>3bv8-a2-m5-cA (length=84) [Search sequence]
ALTAEEIIQYISDAKKFTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKPFYE
AYGSQFEDIEIEDRRNSAIPLKDL
>3bv8-a2-m6-cA (length=84) [Search sequence]
ALTAEEIIQYISDAKKFTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKPFYE
AYGSQFEDIEIEDRRNSAIPLKDL
Structure information
PDB ID 3bv8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N-terminal domain of tetrahydrodipicolinate acetyltransferase from Staphylococcus aureus
Assembly ID 2
Resolution 1.75Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 5 6
Chain ID A A
UniProt accession Q7A2S0 Q7A2S0
Species 158878 (Staphylococcus aureus subsp. aureus Mu50) 158878 (Staphylococcus aureus subsp. aureus Mu50)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3bv8-a2-m5-cA_3bv8-a2-m6-cA.pdb.gz
Full biological assembly
Download: 3bv8-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3bv8/2/1:A/2:A 3bv8/2/1:A/3:A 3bv8/2/2:A/3:A 3bv8/2/4:A/5:A 3bv8/2/4:A/6:A
Other dimers with similar sequences but different poses
  • 3bv8/2/3:A/6:A 3bv8/2/1:A/5:A 3bv8/2/2:A/4:A
  • 3bv8/2/1:A/6:A 3bv8/2/2:A/5:A 3bv8/2/3:A/4:A
  • [Back to Home]