3bw1/1/4:A/4:B

Sequences
>3bw1-a1-m4-cA (length=86) [Search sequence]
HHMETPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSE
SERRCEMVFIRGDTVTLISTPSAVEI
>3bw1-a1-m4-cB (length=86) [Search sequence]
HHMETPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSE
SERRCEMVFIRGDTVTLISTPSAVEI
Structure information
PDB ID 3bw1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of homomeric yeast Lsm3 exhibiting novel octameric ring organisation
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 60
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 4
Chain ID A B
UniProt accession P57743 P57743
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3bw1-a1-m4-cA_3bw1-a1-m4-cB.pdb.gz
Full biological assembly
Download: 3bw1-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3bw1/1/1:A/1:B 3bw1/1/1:A/3:B 3bw1/1/1:B/4:A 3bw1/1/2:A/2:B 3bw1/1/2:A/4:B 3bw1/1/2:B/3:A 3bw1/1/3:A/3:B
Other dimers with similar sequences but different poses
  • 4n0a/1/1:A/2:B 4m7a/3/1:C/1:J 4n0a/1/1:B/2:A
  • [Back to Home]