3by6/1/1:A/1:D

Sequences
>3by6-a1-m1-cA (length=119) [Search sequence]
QAMAITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEA
QKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERIKKIVNDILG
>3by6-a1-m1-cD (length=121) [Search sequence]
QAMAITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEA
QKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERIKKIVNDILGG
K
Structure information
PDB ID 3by6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a transcriptional regulator from Oenococcus oeni
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 98
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A D
UniProt accession Q04D30 Q04D30
Species 203123 (Oenococcus oeni PSU-1) 203123 (Oenococcus oeni PSU-1)
Function annotation BioLiP:3by6A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3by6-a1-m1-cA_3by6-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3by6-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3by6/2/1:B/2:E 3by6/3/1:C/3:C

[Back to Home]