3byb/1/1:B/1:C

Sequences
>3byb-a1-m1-cB (length=58) [Search sequence]
DRPDFCELPADTGPCRVRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCAA
>3byb-a1-m1-cC (length=58) [Search sequence]
KDRPDFCELPADTGPCRVRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCA
Structure information
PDB ID 3byb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Textilinin-1, a Kunitz-type serine protease inhibitor from the Australian Common Brown snake venom
Assembly ID 1
Resolution 1.63Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 0.983
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q90WA1 Q90WA1
Species 169397 (Pseudonaja textilis textilis) 169397 (Pseudonaja textilis textilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3byb-a1-m1-cB_3byb-a1-m1-cC.pdb.gz
Full biological assembly
Download: 3byb-assembly1.cif.gz

[Back to Home]