3c3d/2/1:C/1:D

Sequences

>3c3d-a2-m1-cC (length=298) [Search sequence]

IIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRK
RWWGIENDTFGTYERKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGI
KANILPSDDPVSTYIETAEGIHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKE
ENILIGPSNPITSIGPIISLPGRELLKKKKVVAVSPIIGNAPVSGPAGKLPACGIEVSSG
VAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLTSTEKSKELAEIVVQAFLEH

>3c3d-a2-m1-cD (length=298) [Search sequence]

Structure information

PDB ID	3c3d (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of 2-phospho-(S)-lactate transferase from Methanosarcina mazei in complex with Fo and phosphate. Northeast Structural Genomics Consortium target MaR46
Assembly ID	2
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	61
Sequence identity between the two chains	1.0
PubMed citation	18252724

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q8PVT6	Q8PVT6
Species	192952 (Methanosarcina mazei Go1)	192952 (Methanosarcina mazei Go1)
Function annotation	BioLiP:3c3dC	BioLiP:3c3dD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3c3d-a2-m1-cC_3c3d-a2-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3c3d-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3c3d/1/1:A/1:B 3c3e/1/1:A/1:B 3c3e/2/1:C/1:D 3cgw/1/1:A/2:A