3c8c/1/1:A/1:B

Sequences

>3c8c-a1-m1-cA (length=238) [Search sequence]

SLRSVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIENNPEPDNVRTIISQPLIKNTF
LLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVS
VATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNG
KPSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDELRRS

>3c8c-a1-m1-cB (length=238) [Search sequence]

Structure information

PDB ID	3c8c (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Mcp_N and cache domains of methyl-accepting chemotaxis protein from Vibrio cholerae
Assembly ID	1
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	37
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9KL26	Q9KL26
Species	243277 (Vibrio cholerae O1 biovar El Tor str. N16961)	243277 (Vibrio cholerae O1 biovar El Tor str. N16961)
Function annotation	BioLiP:3c8cA	BioLiP:3c8cB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3c8c-a1-m1-cA_3c8c-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3c8c-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5ave/1/1:A/2:A 5avf/1/1:A/1:B 6iov/1/2:B/1:A