3c8l/1/2:B/1:A

Sequences
>3c8l-a1-m2-cB (length=113) [Search sequence]
GARKRLIIEGGIDQHGQEPTIAASRAVRNAIAHNALPGVWEVAGLSHPNEIIEVQVAVPY
PEQVREEEVLAVLPFGRKTLTVESGGIVQGRAIPELNDKNDELIAIAAVTVLI
>3c8l-a1-m1-cA (length=115) [Search sequence]
GARKRLIIEGGIDQHGQEPTIAASRAVRNAIAHNALPGVWEVAGLSHPNEIIEVQVAVPY
PEQVREEEVLAVLPFGRKTLTVESGGIVQGRAIPELNDKNDELIAIAAVTVLIEN
Structure information
PDB ID 3c8l (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a ftsz-like protein of unknown function (npun_r1471) from nostoc punctiforme pcc 73102 at 1.22 A resolution
Assembly ID 1
Resolution 1.22Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID B A
UniProt accession
Species 63737 (Nostoc punctiforme PCC 73102) 63737 (Nostoc punctiforme PCC 73102)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3c8l-a1-m2-cB_3c8l-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3c8l-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3c8l/1/1:B/2:B 3c8l/1/1:A/2:A
  • 3c8l/1/2:B/2:A 3c8l/1/1:B/1:A
  • [Back to Home]