3ce8/1/2:A/3:A

Sequences
>3ce8-a1-m2-cA (length=87) [Search sequence]
STEQLLVLIAQNDIKDDIVDTLIELEFLSGFSLGNICGFSREGYREFCKFEIHPAAQQAA
LLTALALVCKHNPCRYWIPIYQNGTLS
>3ce8-a1-m3-cA (length=87) [Search sequence]
STEQLLVLIAQNDIKDDIVDTLIELEFLSGFSLGNICGFSREGYREFCKFEIHPAAQQAA
LLTALALVCKHNPCRYWIPIYQNGTLS
Structure information
PDB ID 3ce8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a duf3240 family protein (sbal_0098) from shewanella baltica os155 at 2.40 A resolution
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 63
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession A3CYS0 A3CYS0
Species 325240 (Shewanella baltica OS155) 325240 (Shewanella baltica OS155)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3ce8-a1-m2-cA_3ce8-a1-m3-cA.pdb.gz
Full biological assembly
Download: 3ce8-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ce8/1/1:A/2:A 3ce8/1/1:A/3:A

[Back to Home]