3cht/1/1:B/1:A

Sequences

>3cht-a1-m1-cB (length=300) [Search sequence]

GSATLGRLVRAWPRRAAVVNKADILDEWADYDTLVPDYPLEIVPFAEHPLFLAAEPHQRQ
RVLTGMWIGYNERVIATEQLIAEPAFDLVMHGVFPGSDDPLIRKSVQQAIVDESFHTYMH
MLAIDRTRELRKISERPPQPELVTYRRLRRVLADMPEQWERDIAVLVWGAVAETCINALL
ALLARDATIQPMHSLITTLHLRDETAHGSIVVEVVRELYARMNEQQRRALVRCLPIALEA
FAEQDLSALLLELNAAGIRGAEEIVGDLRLVRDFSGARKMVEQLGLDDAVDFDFPERPDW

>3cht-a1-m1-cA (length=301) [Search sequence]

Structure information

PDB ID	3cht (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Di-iron AurF with partially bound Ligand
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	64
Sequence identity between the two chains	1.0
PubMed citation	18458342

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q70KH9	Q70KH9
Species	66431 (Streptomyces thioluteus)	66431 (Streptomyces thioluteus)
Function annotation	BioLiP:3chtB	BioLiP:3chtA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3cht-a1-m1-cB_3cht-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3cht-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2jcd/1/1:B/1:A 3chh/1/1:B/1:A 3chi/1/1:A/1:B 3chu/1/1:A/1:B