3ci7/1/1:B/1:D

Sequences
>3ci7-a1-m1-cB (length=56) [Search sequence]
RPAFCLEPPYAGPGKARIIRYFYNAAAGAAQAFVYGGARAKRNNFASAADALAACA
>3ci7-a1-m1-cD (length=57) [Search sequence]
RPAFCLEPPYAGPGKARIIRYFYNAAAGAAQAFVYGGARAKRNNFASAADALAACAA
Structure information
PDB ID 3ci7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a simplified BPTI containing 20 alanines
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession
Species
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ci7-a1-m1-cB_3ci7-a1-m1-cD.pdb.gz
Full biological assembly
Download: 3ci7-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3aud/4/2:A/2:B 3aud/4/1:A/1:B 3aud/4/1:C/2:C
  • 3aud/4/1:A/2:B 3aud/4/1:A/2:C 3aud/4/1:B/1:C 3aud/4/1:B/2:A 3aud/4/2:A/1:C 3aud/4/2:B/2:C
  • 3ci7/1/1:D/1:C 3ci7/1/1:B/1:A
  • [Back to Home]