3ci9/1/2:B/3:B

Sequences
>3ci9-a1-m2-cB (length=45) [Search sequence]
VQDLTSVVQTLLQQMQDKFQTISDQIIGRIDDMSSRIDDLEKNIA
>3ci9-a1-m3-cB (length=45) [Search sequence]
VQDLTSVVQTLLQQMQDKFQTISDQIIGRIDDMSSRIDDLEKNIA
Structure information
PDB ID 3ci9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the human HSBP1
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession O75506 O75506
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ci9-a1-m2-cB_3ci9-a1-m3-cB.pdb.gz
Full biological assembly
Download: 3ci9-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ci9/1/1:A/2:A 3ci9/1/1:A/3:A 3ci9/1/1:B/2:B 3ci9/1/1:B/3:B 3ci9/1/2:A/3:A

[Back to Home]