3cjx/9/1:C/1:A

Sequences
>3cjx-a9-m1-cC (length=153) [Search sequence]
EKLLTVDTTAHPFLKALGGHEGTDIFPLFDPYNGLVRASFAPGLTLPLHFHTGTVHYTIS
GCWYYTEYPGQKQTAGCYLYEPGGSIHQFNTPRDNEGQTEVIFLSGCNVNFTQDGTYLGL
SDAGVIKNWVDRAIREQDNGLRYIAAAVPTYAA
>3cjx-a9-m1-cA (length=157) [Search sequence]
ITHQEKLLTVDTTAHPFLKALGGHEGTDIFPLFDPYNGLVRASFAPGLTLPLHFHTGTVH
YTISGCWYYTEYPGQKQTAGCYLYEPGGSIHQFNTPRDNEGQTEVIFLSGCNVNFTQDGT
YLGLSDAGVIKNWVDRAIREQDNGLRYIAAAVPTYAA
Structure information
PDB ID 3cjx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a protein of unknown function with a cupin-like fold (reut_b4571) from ralstonia eutropha jmp134 at 2.60 A resolution
Assembly ID 9
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 70
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C A
UniProt accession Q46SG3 Q46SG3
Species 264198 (Cupriavidus pinatubonensis JMP134) 264198 (Cupriavidus pinatubonensis JMP134)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3cjx-a9-m1-cC_3cjx-a9-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3cjx-assembly9.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3cjx/10/1:F/1:G 3cjx/10/1:H/1:E 3cjx/11/1:B/1:D 3cjx/11/1:C/1:A 3cjx/11/1:F/1:G 3cjx/11/1:H/1:E 3cjx/9/1:B/1:D
Other dimers with similar sequences but different poses
  • 3cjx/9/1:C/1:D 3cjx/10/1:F/1:E 3cjx/10/1:G/1:H 3cjx/11/1:B/1:A 3cjx/11/1:C/1:D 3cjx/11/1:F/1:E 3cjx/11/1:G/1:H 3cjx/9/1:B/1:A
  • 3cjx/9/1:D/1:A 3cjx/10/1:F/1:H 3cjx/10/1:G/1:E 3cjx/11/1:B/1:C 3cjx/11/1:D/1:A 3cjx/11/1:F/1:H 3cjx/11/1:G/1:E 3cjx/9/1:B/1:C
  • 3cjx/11/1:C/1:H 3cjx/11/1:G/1:D
  • [Back to Home]