3cjx/9/1:D/1:A

Sequences

>3cjx-a9-m1-cD (length=154) [Search sequence]

QEKLLTVDTTAHPFLKALGGHEGTDIFPLFDPYNGLVRASFAPGLTLPLHFHTGTVHYTI SGCWYYTEYPGQKQTAGCYLYEPGGSIHQFNTPRDNEGQTEVIFLSGCNVNFTQDGTYLG LSDAGVIKNWVDRAIREQDNGLRYIAAAVPTYAA

>3cjx-a9-m1-cA (length=157) [Search sequence]

ITHQEKLLTVDTTAHPFLKALGGHEGTDIFPLFDPYNGLVRASFAPGLTLPLHFHTGTVH YTISGCWYYTEYPGQKQTAGCYLYEPGGSIHQFNTPRDNEGQTEVIFLSGCNVNFTQDGT YLGLSDAGVIKNWVDRAIREQDNGLRYIAAAVPTYAA

Structure information

PDB ID	3cjx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a protein of unknown function with a cupin-like fold (reut_b4571) from ralstonia eutropha jmp134 at 2.60 A resolution
Assembly ID	9
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	56
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	Q46SG3	Q46SG3
Species	264198 (Cupriavidus pinatubonensis JMP134)	264198 (Cupriavidus pinatubonensis JMP134)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3cjx-a9-m1-cD_3cjx-a9-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3cjx-assembly9.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3cjx/10/1:F/1:H 3cjx/10/1:G/1:E 3cjx/11/1:B/1:C 3cjx/11/1:D/1:A 3cjx/11/1:F/1:H 3cjx/11/1:G/1:E 3cjx/9/1:B/1:C
Other dimers with similar sequences but different poses	3cjx/9/1:C/1:D 3cjx/10/1:F/1:E 3cjx/10/1:G/1:H 3cjx/11/1:B/1:A 3cjx/11/1:C/1:D 3cjx/11/1:F/1:E 3cjx/11/1:G/1:H 3cjx/9/1:B/1:A 3cjx/9/1:C/1:A 3cjx/10/1:F/1:G 3cjx/10/1:H/1:E 3cjx/11/1:B/1:D 3cjx/11/1:C/1:A 3cjx/11/1:F/1:G 3cjx/11/1:H/1:E 3cjx/9/1:B/1:D 3cjx/11/1:C/1:H 3cjx/11/1:G/1:D