3ck4/3/1:I/1:L

Sequences
>3ck4-a3-m1-cI (length=31) [Search sequence]
MKVKQLVDKVEELLSKNYHLVNEVARLVKLV
>3ck4-a3-m1-cL (length=31) [Search sequence]
MKVKQLVDKVEELLSKNYHLVNEVARLVKLV
Structure information
PDB ID 3ck4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title A heterospecific leucine zipper tetramer
Assembly ID 3
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I L
UniProt accession P03069 P03069
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ck4-a3-m1-cI_3ck4-a3-m1-cL.pdb.gz
Full biological assembly
Download: 3ck4-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ck4/2/1:H/1:E 3crp/1/1:A/1:D
Other dimers with similar sequences but different poses
  • 2ipz/1/1:A/1:D 2ipz/1/1:A/1:B 2ipz/1/1:C/1:D
  • 2ipz/1/1:B/1:C 2ipz/1/1:A/1:C
  • 2nrn/1/1:C/1:D 2nrn/1/1:A/1:B
  • [Back to Home]