3cm2/5/1:E/1:G

Sequences
>3cm2-a5-m1-cE (length=102) [Search sequence]
TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPS
EDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT
>3cm2-a5-m1-cG (length=102) [Search sequence]
TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPS
EDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT
Structure information
PDB ID 3cm2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of XIAP BIR3 domain in complex with a Smac-mimetic compound, Smac010
Assembly ID 5
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
PubMed citation 18851976
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E G
UniProt accession P98170 P98170
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3cm2E BioLiP:3cm2G
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3cm2-a5-m1-cE_3cm2-a5-m1-cG.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3cm2-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2opz/1/1:A/1:C 2opz/2/1:B/1:D 3clx/5/1:C/1:A 3clx/6/1:B/2:D 3cm2/1/1:D/2:F 3cm2/2/1:A/3:J 3cm2/3/1:H/1:B 3cm2/4/1:C/1:I 3cm7/1/1:D/1:B 3cm7/2/1:A/2:C 3eyl/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 4ec4/5/1:L/1:E 4ec4/1/1:F/1:A 4ec4/2/1:B/1:G 4ec4/3/1:C/1:J 4ec4/4/1:D/1:K
  • 4hy0/3/1:E/1:D 4hy0/1/1:A/1:B 4hy0/2/1:H/1:C 4hy0/4/1:F/1:G
  • 5oqw/1/1:A/1:B 6h6q/1/1:B/1:A
    		•

    [Back to Home]