3cp1/1/2:A/3:A

Sequences
>3cp1-a1-m2-cA (length=73) [Search sequence]
TVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLMEWDREINNYTSLIHSLIEES
QNQQEKNEQELLE
>3cp1-a1-m3-cA (length=73) [Search sequence]
TVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLMEWDREINNYTSLIHSLIEES
QNQQEKNEQELLE
Structure information
PDB ID 3cp1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a longer thermalstable core domain of HIV-1 gp41 containing the enfuvirtide resistance mutation N43D
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 72
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession Q53I19 Q53I19
Species 11676 (Human immunodeficiency virus 1) 11676 (Human immunodeficiency virus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3cp1-a1-m2-cA_3cp1-a1-m3-cA.pdb.gz
Full biological assembly
Download: 3cp1-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3cp1/1/1:A/2:A 3cp1/1/1:A/3:A 3cyo/1/1:A/2:A 3cyo/1/1:A/3:A 3cyo/1/2:A/3:A

[Back to Home]