3cs5/2/1:C/1:D

Sequences
>3cs5-a2-m1-cC (length=48) [Search sequence]
VEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS
>3cs5-a2-m1-cD (length=48) [Search sequence]
VEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS
Structure information
PDB ID 3cs5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title NblA protein from Synechococcus elongatus PCC 7942
Assembly ID 2
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 78
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P35087 P35087
Species 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) 1140 (Synechococcus elongatus PCC 7942 = FACHB-805)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3cs5-a2-m1-cC_3cs5-a2-m1-cD.pdb.gz
Full biological assembly
Download: 3cs5-assembly2.cif.gz
Similar dimers

[Back to Home]