3csx/2/2:A/1:B

Sequences
>3csx-a2-m2-cA (length=61) [Search sequence]
ADLKKKVRKLNSKAGQMKMDLHDLAEGLPTDYENLVETAEKTYEIFRELDQLKKKLNIWE
E
>3csx-a2-m1-cB (length=71) [Search sequence]
TDNNPTPEAVADLKKKVRKLNSKAGQMKMDLHDLAEGLPTDYENLVETAEKTYEIFRELD
QLKKKLNIWEE
Structure information
PDB ID 3csx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural characterization of a protein in the DUF683 family- crystal structure of cce_0567 from the cyanobacterium Cyanothece 51142.
Assembly ID 2
Resolution 1.84Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 72
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID A B
UniProt accession A1KYE3 A1KYE3
Species 43989 (Crocosphaera subtropica ATCC 51142) 43989 (Crocosphaera subtropica ATCC 51142)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3csx-a2-m2-cA_3csx-a2-m1-cB.pdb.gz
Full biological assembly
Download: 3csx-assembly2.cif.gz

[Back to Home]