3cto/7/1:A/1:B

Sequences
>3cto-a7-m1-cA (length=68) [Search sequence]
MSISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENAR
RLMEAVAR
>3cto-a7-m1-cB (length=83) [Search sequence]
SISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENARR
LMEAVARDKAGHSAFTKSVDELR
Structure information
PDB ID 3cto (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of M. tuberculosis YefM antitoxin
Assembly ID 7
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 90
Sequence identity between the two chains 0.985
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P9WF25 P9WF25
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3cto-a7-m1-cA_3cto-a7-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3cto-assembly7.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3cto/10/1:A/1:B 3cto/1/1:A/1:B 3cto/1/1:D/1:C 3cto/4/1:A/1:B 3cto/4/1:D/1:C 3cto/5/1:A/1:B 3cto/6/1:D/1:C 3cto/9/1:D/1:C 3d55/1/1:A/1:B 3d55/3/1:A/1:B
Other dimers with similar sequences but different poses
  • 3d55/4/1:A/1:C 3cto/11/1:A/1:C 3cto/12/1:D/1:B 3cto/13/1:D/1:B 3cto/1/1:A/1:C 3cto/1/1:D/1:B 3cto/3/1:A/1:C 3cto/3/3:D/3:B 3cto/4/1:A/1:C 3cto/4/1:D/1:B 3cto/5/1:D/1:B 3cto/6/1:D/1:B 3cto/7/1:D/1:B 3d55/1/1:A/1:C 3d55/2/1:A/1:C 3d55/3/1:A/1:C
  • 3cto/6/5:A/1:B 3cto/13/5:A/1:B 3cto/3/1:A/3:B
  • 3cto/7/1:D/1:A 3cto/1/1:B/1:C 3cto/1/1:D/1:A 3cto/4/1:B/1:C 3cto/4/1:D/1:A 3cto/5/1:D/1:A 3cto/6/1:B/1:C 3d55/1/1:B/1:C 3d55/3/1:B/1:C
  • 3d55/4/2:B/1:C 3cto/3/3:B/1:C 3cto/5/1:B/5:C 3d55/2/2:B/1:C
  • 3cto/5/1:D/5:C 3cto/3/3:D/1:C
  • 3oei/3/1:I/1:J 3oei/1/1:A/1:B 3oei/2/1:E/1:F 3oei/4/1:N/1:M
  • [Back to Home]