3ctr/2/1:A/4:A

Sequences
>3ctr-a2-m1-cA (length=75) [Search sequence]
GPLGSDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSK
YAESYRIQTYAEYMG
>3ctr-a2-m4-cA (length=75) [Search sequence]
GPLGSDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSK
YAESYRIQTYAEYMG
Structure information
PDB ID 3ctr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the RRM-domain of the poly(A)-specific ribonuclease PARN bound to m7GTP
Assembly ID 2
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
PubMed citation 18694759
Chain information
Chain 1 Chain 2
Model ID 1 4
Chain ID A A
UniProt accession O95453 O95453
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3ctrA BioLiP:3ctrA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3ctr-a2-m1-cA_3ctr-a2-m4-cA.pdb.gz
Full biological assembly
Download: 3ctr-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3ctr/2/3:A/4:A 3ctr/2/1:A/2:A
  • 3ctr/2/2:A/4:A 3ctr/2/1:A/3:A
    		•

    [Back to Home]