3cvj/2/1:C/1:D

Sequences

>3cvj-a2-m1-cC (length=234) [Search sequence]

TSSFTDYCKFFNRILSEVQETQEQAIIKGAHLVSEAVNGGRFYVFGSGHSHIAEEIYNRA
GGLALVTAILPPELLHERPNKSTYLERIEGLSKSYLKLHQVTNKDVIIISNSGRNTVPVE
AIESRNIGAKVIATSKHSQKVTSRHKSGKKLYEYADVVLDNGAPVGDAGFQIANSEIYSG
ATSDSIGCFLAQALIVETLHLLVQQGFEPPVFKSSNVDGADLYNDKIFNEYVKW

>3cvj-a2-m1-cD (length=234) [Search sequence]

Structure information

PDB ID	3cvj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a putative phosphoheptose isomerase (bh3325) from bacillus halodurans c-125 at 2.00 A resolution
Assembly ID	2
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	230
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q9K7N6	Q9K7N6
Species	272558 (Halalkalibacterium halodurans C-125)	272558 (Halalkalibacterium halodurans C-125)
Function annotation	BioLiP:3cvjC	BioLiP:3cvjD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3cvj-a2-m1-cC_3cvj-a2-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3cvj-assembly2.cif.gz

Similar dimers