3cwt/1/1:B/1:C

Sequences

>3cwt-a1-m1-cB (length=281) [Search sequence]

MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLH
INLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRA
ILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAE
ALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYL
IKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDE

>3cwt-a1-m1-cC (length=282) [Search sequence]

Structure information

PDB ID	3cwt (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of an AlkA Host/Guest Complex 2'-fluoro-2'-deoxyinosine:Adenine Base Pair
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	96
Sequence identity between the two chains	1.0
PubMed citation	18682218

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P04395	P04395
Species	83333 (Escherichia coli K-12)	83333 (Escherichia coli K-12)
Function annotation	BioLiP:3cwtB	BioLiP:3cwtC

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3cwt-a1-m1-cB_3cwt-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3cwt-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3cvs/1/1:A/1:D 3cvs/1/1:B/1:C 3cvt/1/1:A/1:D 3cvt/1/1:B/1:C 3cw7/1/1:A/1:D 3cw7/1/1:B/1:C 3cwa/1/1:A/1:D 3cwa/1/1:B/1:C 3cws/1/1:C/1:B 3cws/1/1:D/1:A 3cwt/1/1:D/1:A 3cwu/1/1:A/1:D 3cwu/1/1:B/1:C 3d4v/1/1:C/1:B 3d4v/1/1:D/1:A