3cz1/1/1:B/1:A

Sequences

>3cz1-a1-m1-cB (length=115) [Search sequence]

VPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEAN VDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI

>3cz1-a1-m1-cA (length=117) [Search sequence]

DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDE ANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI

Structure information

PDB ID	3cz1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Dimeric crystal structure of a pheromone binding protein from Apis mellifera in complex with the n-butyl benzene sulfonamide at pH 7.0
Assembly ID	1
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	92
Sequence identity between the two chains	1.0
PubMed citation	19481550

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q9U9J6	Q9U9J6
Species	7460 (Apis mellifera)	7460 (Apis mellifera)
Function annotation	BioLiP:3cz1B	BioLiP:3cz1A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3cz1-a1-m1-cB_3cz1-a1-m1-cA.pdb.gz

Full biological assembly Download: 3cz1-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3cyz/1/1:B/1:A 3cz0/1/1:B/1:A 3cz2/1/1:B/1:A
Other dimers with similar sequences but different poses	3d73/1/1:A/1:B 3d74/1/1:A/1:B 3d78/1/1:A/1:B