3d3r/2/2:B/1:A

Sequences
>3d3r-a2-m2-cB (length=77) [Search sequence]
YFQGCLSIPSQVVAVDNERQSVTVDTLGVRRDVSSHLTEPLAIGDYVLIHIGFVNKIDRN
DALQSLELYQEIVSKLE
>3d3r-a2-m1-cA (length=80) [Search sequence]
ENLYFQGCLSIPSQVVAVDNERQSVTVDTLGVRRDVSSHLTEPLAIGDYVLIHIGFVNKI
DRNDALQSLELYQEIVSKLE
Structure information
PDB ID 3d3r (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the hydrogenase assembly chaperone HypC/HupF family protein from Shewanella oneidensis MR-1
Assembly ID 2
Resolution 1.85Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID B A
UniProt accession Q8EF93 Q8EF93
Species 211586 (Shewanella oneidensis MR-1) 211586 (Shewanella oneidensis MR-1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3d3r-a2-m2-cB_3d3r-a2-m1-cA.pdb.gz
Full biological assembly
Download: 3d3r-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3d3r/2/2:B/2:A 3d3r/1/1:B/1:A 3d3r/2/1:B/1:A
  • 3d3r/2/1:B/2:B 3d3r/2/1:A/2:A
  • [Back to Home]