3d47/5/1:D/1:H

Sequences

>3d47-a5-m1-cD (length=405) [Search sequence]

MENIMTLPKIKHVRAWFIGGATAEKGAGGGDYHDQGGNHWIDDHIATPMSKYRDYEQSRQ
SFGINVLGTLIVEVEAENRQTGFAVSTAGEMGCFIVEKHLNRFIEGKCVSDIKLIHDQML
GATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDLA
KEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGPDFWLMLDCWMSQDVNYATKLA
HACAPFNLKWIEECLPPQQYEGYRELKRNAPAGMMVTSGEHHGTLQSFRTLAETGIDIMQ
PDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLMTSPDCSTL
RPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNRDCHLKRPYSH

>3d47-a5-m1-cH (length=405) [Search sequence]

Structure information

PDB ID	3d47 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of L-rhamnonate dehydratase from Salmonella typhimurium complexed with Mg and D-malate
Assembly ID	5
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	24
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	H
UniProt accession	Q8ZNF9	Q8ZNF9
Species	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)
Function annotation	BioLiP:3d47D	BioLiP:3d47H

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3d47-a5-m1-cD_3d47-a5-m1-cH.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3d47-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2gsh/1/1:A/3:B 2gsh/1/1:A/4:B 2gsh/1/1:B/3:A 2gsh/1/1:B/4:A 2gsh/1/2:A/3:B 2gsh/1/2:A/4:B 2gsh/1/2:B/3:A 2gsh/1/2:B/4:A 2i5q/2/1:A/3:A 2i5q/2/1:A/4:A 2i5q/2/1:B/3:B 2i5q/2/1:B/4:B 2i5q/2/2:A/3:A 2i5q/2/2:A/4:A 2i5q/2/2:B/3:B 2i5q/2/2:B/4:B 2p3z/1/1:A/3:A 2p3z/1/1:A/4:A 2p3z/1/1:B/3:B 2p3z/1/1:B/4:B 2p3z/1/2:A/3:A 2p3z/1/2:A/4:A 2p3z/1/2:B/3:B 2p3z/1/2:B/4:B 3box/2/1:A/3:A 3box/2/1:A/4:A 3box/2/1:B/3:B 3box/2/1:B/4:B 3box/2/2:A/3:A 3box/2/2:A/4:A 3box/2/2:B/3:B 3box/2/2:B/4:B 3cxo/2/1:A/3:A 3cxo/2/1:A/4:A 3cxo/2/1:B/3:B 3cxo/2/1:B/4:B 3cxo/2/2:A/3:A 3cxo/2/2:A/4:A 3cxo/2/2:B/3:B 3cxo/2/2:B/4:B 3d46/5/1:A/1:F 3d46/5/1:A/1:G 3d46/5/1:B/1:E 3d46/5/1:B/1:H 3d46/5/1:C/1:F 3d46/5/1:C/1:G 3d46/5/1:D/1:E 3d46/5/1:D/1:H 3d47/5/1:A/1:F 3d47/5/1:A/1:G 3d47/5/1:B/1:E 3d47/5/1:B/1:H 3d47/5/1:C/1:F 3d47/5/1:C/1:G 3d47/5/1:D/1:E

Other dimers with similar sequences but different poses

3d47/5/1:G/1:H 2gsh/1/1:A/1:B 2gsh/1/2:A/2:B 2gsh/1/3:A/3:B 2gsh/1/4:A/4:B 2i5q/1/1:A/1:B 2i5q/2/1:A/1:B 2i5q/2/2:A/2:B 2i5q/2/3:A/3:B 2i5q/2/4:A/4:B 2p3z/1/1:A/1:B 2p3z/1/2:A/2:B 2p3z/1/3:A/3:B 2p3z/1/4:A/4:B 3box/1/1:A/1:B 3box/2/1:A/1:B 3box/2/2:A/2:B 3box/2/3:A/3:B 3box/2/4:A/4:B 3cxo/1/1:A/1:B 3cxo/2/1:A/1:B 3cxo/2/2:A/2:B 3cxo/2/3:A/3:B 3cxo/2/4:A/4:B 3d46/1/1:A/1:B 3d46/2/1:C/1:D 3d46/3/1:E/1:F 3d46/4/1:G/1:H 3d46/5/1:A/1:B 3d46/5/1:C/1:D 3d46/5/1:E/1:F 3d46/5/1:G/1:H 3d47/1/1:A/1:B 3d47/2/1:C/1:D 3d47/3/1:E/1:F 3d47/4/1:G/1:H 3d47/5/1:A/1:B 3d47/5/1:C/1:D 3d47/5/1:E/1:F

3d47/5/1:C/1:H 2gsh/1/1:A/3:A 2gsh/1/1:B/4:B 2gsh/1/2:A/4:A 2gsh/1/2:B/3:B 2i5q/2/1:A/4:B 2i5q/2/2:A/3:B 2i5q/2/3:A/1:B 2i5q/2/4:A/2:B 2p3z/1/1:A/4:B 2p3z/1/1:B/3:A 2p3z/1/2:A/3:B 2p3z/1/2:B/4:A 3box/2/1:A/4:B 3box/2/1:B/3:A 3box/2/2:A/3:B 3box/2/2:B/4:A 3cxo/2/1:A/3:B 3cxo/2/1:B/4:A 3cxo/2/2:A/4:B 3cxo/2/2:B/3:A 3d46/5/1:A/1:E 3d46/5/1:B/1:G 3d46/5/1:C/1:H 3d46/5/1:D/1:F 3d47/5/1:A/1:E 3d47/5/1:B/1:G 3d47/5/1:D/1:F