3d54/3/1:B/1:C

Sequences
>3d54-a3-m1-cB (length=82) [Search sequence]
MPLFKFAIDVQYRSNVRDPRGETIERVLREEKGLPVKKLRLGKSIHLEVEAENKEKAYEI
VKKACEELLVNPVVEEYEVREL
>3d54-a3-m1-cC (length=82) [Search sequence]
MPLFKFAIDVQYRSNVRDPRGETIERVLREEKGLPVKKLRLGKSIHLEVEAENKEKAYEI
VKKACEELLVNPVVEEYEVREL
Structure information
PDB ID 3d54 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of PurLQS from Thermotoga maritima
Assembly ID 3
Resolution 3.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 103
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q9X0X1 Q9X0X1
Species 2336 (Thermotoga maritima) 2336 (Thermotoga maritima)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3d54-a3-m1-cB_3d54-a3-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3d54-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1vq3/1/1:B/1:A 1vq3/1/1:D/1:C 1vq3/2/1:D/1:C 1vq3/3/1:B/1:A 3d54/1/1:J/1:K 3d54/2/1:F/1:G
Other dimers with similar sequences but different poses
  • 1vq3/1/1:D/1:A 1vq3/1/1:B/1:C
  • [Back to Home]