3d6m/1/1:A/2:A

Sequences
>3d6m-a1-m1-cA (length=173) [Search sequence]
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEV
DITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGIC
GKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
>3d6m-a1-m2-cA (length=173) [Search sequence]
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEV
DITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGIC
GKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Structure information
PDB ID 3d6m (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of human caspase-1 with a naturally-occurring Lys319->Arg substitution in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-VAD-FMK)
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P29466 P29466
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3d6mA BioLiP:3d6mA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3d6m-a1-m1-cA_3d6m-a1-m2-cA.pdb.gz
Full biological assembly
Download: 3d6m-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1bmq/2/1:A/2:A 1ibc/1/1:A/2:A 1ice/1/1:A/2:A 1rwk/1/1:A/2:A 1rwm/1/1:A/2:A 1rwn/1/1:A/2:A 1rwo/1/1:A/2:A 1rwp/1/1:A/2:A 1rwv/1/1:A/2:A 1rww/1/1:A/2:A 1rwx/1/1:A/2:A 1sc3/1/1:A/2:A 2fqq/1/1:A/2:A 2h48/1/1:A/2:A 2h4w/1/1:A/2:A 2h51/1/1:A/2:A 2h54/1/1:A/2:A 2hbq/1/1:A/2:A 2hbr/1/1:A/2:A 2hby/1/1:A/2:A 3d6f/1/1:A/2:A 3ns7/2/1:A/2:A 6f6r/1/1:A/2:A
Other dimers with similar sequences but different poses
  • 3e4c/1/1:B/1:A 1bmq/2/1:B/2:B 1ibc/1/1:B/2:B 1ice/1/1:B/2:B 1rwk/1/1:B/2:B 1rwm/1/1:B/2:B 1rwn/1/1:B/2:B 1rwo/1/1:B/2:B 1rwp/1/1:B/2:B 1rwv/1/1:B/2:B 1rww/1/1:B/2:B 1rwx/1/1:B/2:B 1sc3/1/1:B/2:B 1sc4/1/1:B/2:B 2fqq/1/1:B/2:B 2h48/1/1:B/2:B 2h4w/1/1:B/2:B 2h4y/1/1:B/2:B 2h51/1/1:B/2:B 2h54/1/1:B/2:B 2hbq/1/1:B/2:B 2hbr/1/1:B/2:B 2hby/1/1:B/2:B 2hbz/1/1:B/2:B 3d6f/1/1:B/2:B 3d6h/1/1:B/2:B 3d6m/1/1:B/2:B 3ns7/2/1:B/2:B 6f6r/1/1:B/2:B
    		•

    [Back to Home]