3d6t/2/1:B/2:B

Sequences

>3d6t-a2-m1-cB (length=120) [Search sequence]

KLIVGNTGSGKTTLLQLGIDVKDWPLVLVWDFAGREEFYSTHPHFTQRALYLAVYDLSKG QAEVDAKPWLFNIKARASSSPVILVGTHLDVSDKILLGFPAIRDYHFVNATEESLRKTII

>3d6t-a2-m2-cB (length=120) [Search sequence]

KLIVGNTGSGKTTLLQLGIDVKDWPLVLVWDFAGREEFYSTHPHFTQRALYLAVYDLSKG QAEVDAKPWLFNIKARASSSPVILVGTHLDVSDKILLGFPAIRDYHFVNATEESLRKTII

Structure information

PDB ID	3d6t (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
Assembly ID	2
Resolution	2.43Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	132
Sequence identity between the two chains	1.0
PubMed citation	18230735

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	B	B
UniProt accession	Q5S007	Q5S007
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3d6tB	BioLiP:3d6tB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3d6t-a2-m1-cB_3d6t-a2-m2-cB.pdb.gz

Full biological assembly Download: 3d6t-assembly2.cif.gz