3d6w/1/2:A/4:B

Sequences
>3d6w-a1-m2-cA (length=107) [Search sequence]
GKSVVTLKTTDGWIPVPFSKVYLEAKDKKTYVNAEELTGTHKYSLQEFEYLLPKDSFIRC
HRSFIVNVNHIKAIYPDTHSTFLLSDNGERVPVSQSYASYFRKLLGF
>3d6w-a1-m4-cB (length=107) [Search sequence]
KSVVTLKTTDGWIPVPFSKVYLEAKDKKTYVNAEELTGTHKYSLQEFEYLLPKDSFIRCH
RSFIVNVNHIKAIYPDTHSTFLLSDNGERVPVSQSYASYFRKLLGFG
Structure information
PDB ID 3d6w (database links: RCSB PDB PDBe PDBj PDBsum)
Title LytTr DNA-binding domain of putative methyl-accepting/DNA response regulator from Bacillus cereus.
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 42
Sequence identity between the two chains 0.991
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A B
UniProt accession Q73A38 Q73A38
Species 222523 (Bacillus cereus ATCC 10987) 222523 (Bacillus cereus ATCC 10987)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3d6w-a1-m2-cA_3d6w-a1-m4-cB.pdb.gz
Full biological assembly
Download: 3d6w-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3d6w/1/1:A/3:B 3d6w/1/1:A/4:B 3d6w/1/2:A/3:B

[Back to Home]