3d73/1/1:A/1:B

Sequences

>3d73-a1-m1-cA (length=119) [Search sequence]

APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVAKGNLVNEPSITCYMYCLLEAFSLVD DEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI

>3d73-a1-m1-cB (length=119) [Search sequence]

APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVAKGNLVNEPSITCYMYCLLEAFSLVD DEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI

Structure information

PDB ID	3d73 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a pheromone binding protein mutant D35A, from Apis mellifera, at pH 7.0
Assembly ID	1
Resolution	2.03Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	34
Sequence identity between the two chains	1.0
PubMed citation	19481550

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9U9J6	Q9U9J6
Species	7460 (Apis mellifera)	7460 (Apis mellifera)
Function annotation	BioLiP:3d73A	BioLiP:3d73B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3d73-a1-m1-cA_3d73-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3d73-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3d74/1/1:A/1:B 3d78/1/1:A/1:B
Other dimers with similar sequences but different poses	3cz1/1/1:B/1:A 3cyz/1/1:B/1:A 3cz0/1/1:B/1:A 3cz2/1/1:B/1:A