3d73/1/1:A/1:B

Sequences
>3d73-a1-m1-cA (length=119) [Search sequence]
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVAKGNLVNEPSITCYMYCLLEAFSLVD
DEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
>3d73-a1-m1-cB (length=119) [Search sequence]
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVAKGNLVNEPSITCYMYCLLEAFSLVD
DEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Structure information
PDB ID 3d73 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a pheromone binding protein mutant D35A, from Apis mellifera, at pH 7.0
Assembly ID 1
Resolution 2.03Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
PubMed citation 19481550
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9U9J6 Q9U9J6
Species 7460 (Apis mellifera) 7460 (Apis mellifera)
Function annotation BioLiP:3d73A BioLiP:3d73B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3d73-a1-m1-cA_3d73-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3d73-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3d74/1/1:A/1:B 3d78/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 3cz1/1/1:B/1:A 3cyz/1/1:B/1:A 3cz0/1/1:B/1:A 3cz2/1/1:B/1:A
  • [Back to Home]