3d7i/1/2:C/1:A

Sequences
>3d7i-a1-m2-cC (length=91) [Search sequence]
EGKVVAAAYPDLYDIIVKLNDTVFTGKTLDYKTQKLIAIGIVASRCDEVAIEKQKSAKEL
GITKEEIADVLRVVLLTSGPAFTKAKILEKL
>3d7i-a1-m1-cA (length=92) [Search sequence]
GEGKVVAAAYPDLYDIIVKLNDTVFTGKTLDYKTQKLIAIGIVASRCDEVAIEKQKSAKE
LGITKEEIADVLRVVLLTSGPAFTKAKILEKL
Structure information
PDB ID 3d7i (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in oxygen detoxification (1591455) from METHANOCOCCUS JANNASCHII at 1.75 A resolution
Assembly ID 1
Resolution 1.75Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID C A
UniProt accession Q58152 Q58152
Species 2190 (Methanocaldococcus jannaschii) 2190 (Methanocaldococcus jannaschii)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3d7i-a1-m2-cC_3d7i-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3d7i-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3d7i/1/1:A/1:B 3d7i/1/1:C/2:A 3d7i/1/1:C/2:B 3d7i/1/2:A/2:B 3d7i/1/2:C/1:B
Other dimers with similar sequences but different poses
  • 3d7i/1/2:C/2:B 3d7i/1/1:A/2:A 3d7i/1/1:C/1:B
  • 3d7i/1/2:C/2:A 3d7i/1/1:B/2:B 3d7i/1/1:C/1:A
  • 3d7i/1/1:A/2:B 3d7i/1/1:C/2:C 3d7i/1/2:A/1:B
  • [Back to Home]