3d7q/2/1:A/2:A

Sequences
>3d7q-a2-m1-cA (length=104) [Search sequence]
GDKLNEYRTKVRQLLTKHLQYKGDVEVEQIFDEEHDHYQIISVGWNNQHRIYGPIHLDIK
NNKIWIQQNTTEADIALELEGIDKQDIVIGFHTPKRQLSGFAVE
>3d7q-a2-m2-cA (length=104) [Search sequence]
GDKLNEYRTKVRQLLTKHLQYKGDVEVEQIFDEEHDHYQIISVGWNNQHRIYGPIHLDIK
NNKIWIQQNTTEADIALELEGIDKQDIVIGFHTPKRQLSGFAVE
Structure information
PDB ID 3d7q (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a xisi-like protein (npun_ar114) from nostoc punctiforme pcc 73102 at 2.30 A resolution
Assembly ID 2
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 61
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession B2JAN5 B2JAN5
Species 63737 (Nostoc punctiforme PCC 73102) 63737 (Nostoc punctiforme PCC 73102)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3d7q-a2-m1-cA_3d7q-a2-m2-cA.pdb.gz
Full biological assembly
Download: 3d7q-assembly2.cif.gz
Similar dimers

[Back to Home]