3ddt/2/1:C/2:C

Sequences
>3ddt-a2-m1-cC (length=44) [Search sequence]
GSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQ
>3ddt-a2-m2-cC (length=44) [Search sequence]
GSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQ
Structure information
PDB ID 3ddt (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the B2 box from MuRF1 in dimeric state
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
PubMed citation 18795805
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession Q969Q1 Q969Q1
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3ddtC BioLiP:3ddtC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ddt-a2-m1-cC_3ddt-a2-m2-cC.pdb.gz
Full biological assembly
Download: 3ddt-assembly2.cif.gz
Similar dimers

[Back to Home]