3dgo/1/1:A/2:A

Sequences

>3dgo-a1-m1-cA (length=69) [Search sequence]

DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIFNMCKTCFNNSIDIGDDTYHGH VDWLMYADS

>3dgo-a1-m2-cA (length=69) [Search sequence]

DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIFNMCKTCFNNSIDIGDDTYHGH VDWLMYADS

Structure information

PDB ID	3dgo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	A non-biological ATP binding protein with a Tyr-Phe mutation in the ligand binding domain
Assembly ID	1
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	45
Sequence identity between the two chains	1.0
PubMed citation	19522480

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession
Species	32644 (unidentified)	32644 (unidentified)
Function annotation	BioLiP:3dgoA	BioLiP:3dgoA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3dgo-a1-m1-cA_3dgo-a1-m2-cA.pdb.gz

Full biological assembly Download: 3dgo-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1uw1/1/1:A/2:A 2p05/1/1:A/2:A 2p09/1/1:A/2:A 3lt8/1/1:A/2:A 3lt9/1/1:A/2:A 3lta/1/1:A/2:A 3ltb/1/1:A/2:A 3ltc/1/1:A/2:A 3ltd/1/1:A/2:A