3dj1/3/5:B/6:B

Sequences
>3dj1-a3-m5-cB (length=110) [Search sequence]
TAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSDKGIYVTRVSEGGPAEIAGLQI
GDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSML
>3dj1-a3-m6-cB (length=110) [Search sequence]
TAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSDKGIYVTRVSEGGPAEIAGLQI
GDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSML
Structure information
PDB ID 3dj1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title crystal structure of TIP-1 wild type
Assembly ID 3
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 53
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 5 6
Chain ID B B
UniProt accession Q9DBG9 Q9DBG9
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3dj1-a3-m5-cB_3dj1-a3-m6-cB.pdb.gz
Full biological assembly
Download: 3dj1-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3dj1/3/1:A/2:A 3dj1/3/1:A/3:A 3dj1/3/2:A/3:A 3dj1/3/4:B/5:B 3dj1/3/4:B/6:B
Other dimers with similar sequences but different poses
  • 3dj1/3/6:B/1:A 3dj1/3/4:B/2:A 3dj1/3/5:B/3:A
  • [Back to Home]