3dlu/1/1:D/1:A

Sequences
>3dlu-a1-m1-cD (length=87) [Search sequence]
GRFVVWPSELDSRLSRKYGRIVPRSIAVESPRVEEIVRAAEELKFKVIRVEEDKLLRTFG
MIVLESPYGKSKSLKLIAQKIREFRRR
>3dlu-a1-m1-cA (length=95) [Search sequence]
GRFVVWPSELDSRLSRKYGRIVPRSIAVESPRVEEIVRAAEELKFKVIRVEEDKLNPELR
TFGMIVLESPYGKSKSLKLIAQKIREFRRRSAGTL
Structure information
PDB ID 3dlu (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structures of SRP54 and SRP19, the two proteins assembling the ribonucleic core of the Signal Recognition Particle from the archaeon Pyrococcus furiosus.
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession Q8TZT9 Q8TZT9
Species 2261 (Pyrococcus furiosus) 2261 (Pyrococcus furiosus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3dlu-a1-m1-cD_3dlu-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3dlu-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3dlu/1/1:D/1:C 3dlu/1/1:B/1:A
  • [Back to Home]