3dm1/5/1:C/1:E

Sequences

>3dm1-a5-m1-cC (length=52) [Search sequence]

EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQ

>3dm1-a5-m1-cE (length=53) [Search sequence]

EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQK

Structure information

PDB ID	3dm1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the complex of human chromobox homolog 3 (CBX3) with peptide
Assembly ID	5
Resolution	2.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	15
Sequence identity between the two chains	1.0
PubMed citation	22514736

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	E
UniProt accession	Q13185	Q13185
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3dm1C	BioLiP:3dm1E

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3dm1-a5-m1-cC_3dm1-a5-m1-cE.pdb.gz

Full biological assembly Download: 3dm1-assembly5.cif.gz