3dm1/5/1:C/1:G

Sequences
>3dm1-a5-m1-cC (length=52) [Search sequence]
EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQ
>3dm1-a5-m1-cG (length=53) [Search sequence]
EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQK
Structure information
PDB ID 3dm1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the complex of human chromobox homolog 3 (CBX3) with peptide
Assembly ID 5
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
PubMed citation 22514736
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C G
UniProt accession Q13185 Q13185
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3dm1C BioLiP:3dm1G
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3dm1-a5-m1-cC_3dm1-a5-m1-cG.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3dm1-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3dm1/5/1:E/1:G 3dm1/5/1:A/1:C
    		•

    [Back to Home]