3dm3/1/1:A/2:B

Sequences
>3dm3-a1-m1-cA (length=98) [Search sequence]
DTYNIGELSPGMTATFEGEVISALPIKEFKRADGSIGKLKSFIVRDETGSIRVTLWDNLT
DIDVGRGDYVRVRGYIREGYYGGLECTANYVEILKKGE
>3dm3-a1-m2-cB (length=98) [Search sequence]
DTYNIGELSPGMTATFEGEVISALPIKEFKRADGSIGKLKSFIVRDETGSIRVTLWDNLT
DIDVGRGDYVRVRGYIREGYYGGLECTANYVEILKKGE
Structure information
PDB ID 3dm3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a domain of a Replication factor A protein, from Methanocaldococcus jannaschii. NorthEast Structural Genomics target MjR118E
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 56
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession Q58559 Q58559
Species 2190 (Methanocaldococcus jannaschii) 2190 (Methanocaldococcus jannaschii)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3dm3-a1-m1-cA_3dm3-a1-m2-cB.pdb.gz
Full biological assembly
Download: 3dm3-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3dm3/2/1:A/1:B 3dm3/1/1:A/1:B 3dm3/1/2:A/2:B
  • [Back to Home]